PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496798.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 234aa    MW: 26526.5 Da    PI: 9.5328
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496798.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF671.8e-211664149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+ +n+sn qvtfsk r g++KKA+EL++LC+a+va+++fs+  k++ +
  XP_004496798.1 16 KKMSNESNLQVTFSKHRSGLFKKASELCTLCGAKVALVVFSPAEKVFSF 64
                    5689*****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-29867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.745868IPR002100Transcription factor, MADS-box
CDDcd002651.13E-32977No hitNo description
SuperFamilySSF554553.14E-26984IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-181030IPR002100Transcription factor, MADS-box
PfamPF003195.6E-231864IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MSTRRKSRGR QKVEMKKMSN ESNLQVTFSK HRSGLFKKAS ELCTLCGAKV ALVVFSPAEK  60
VFSFDHPNVD IVIDRYLSLA LPQHNGTMQF IETHHSANVC ELNKTVTQAI NQLHVEKKCG  120
DELNNSCKAT EAQFWSACPI DGMNRTQLEL FKKALKELKK LVAQHVERIV IHGASTQTLP  180
FFLENSFTSN NSVPPHQQQV QMYPLQFFQN PVTPPPHLFD FNNMGVGYGP TKFF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496798.11e-177PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK24e-52AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLG7L6X51e-108G7L6X5_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27330.17e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-47AGAMOUS-like 62